<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8049 CA59208 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 78
2 D4T+DDI+NFV 135
3 D4T+DDI+RTV+SQV 66
4 D4T+DDI+EFV+TDF 99
5 ATV+DDI+RTV+TDF 75

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L33I, N88D I13V, E35D, M36I, N37T, I62V, L63P, A71T, T74S  
>CA59208| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVIEDITLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGSVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E G190E   V35L, K101R, K103R, D177E, I178M, G196E, T200A, E204N, R211K, L228H, V245E, A272P, T286A, E297K  
>CA59209| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVESDLEIEQHRAKIENLRQHLLKWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
L

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006