<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8822 65161 Portugal 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ SQV 82
2 D4T+ 3TC+ NVP+ IDV 108
3 D4T+ DDI+ ABC+ IDV+ LPV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A L24I, F53L L10I, T12I, I15V, G17E, K20M, E35D, M36IV, N37K, L38M, K43R, R57K, Q61N, L63P  
>65161| codons 1-99
PQITLWQRPIVIIKVGEQLMEALIDTGADDTVLEDVKMPGRWRPKMIMGIGGLVKVKQYD
NIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219R Y181C V108I, K238N T7TA, K20R, V35X, K43E, E44D, V60I, K101Q, V118I, K122E, I135L, S162Y, K173A, Q174K, I178L, G196GE, Q197L, E203K, Q207E, R211A, K223Q, L228H, D237DE, V241M, V245Q, E248D, A272P, L283I, T286A, E291D, V292VI, I293V, E297Q, V317A I37IR
>65161| codons 1-335
PISPIEAVPVKLKPGMDGPRVKQWPLTEEKIKALXERCTELEEDGKISKIGPENPYNTPI
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPDLVI
CQYMDDLYVGSDLEIELHRTKIKELREHLWAWGFYTPDRKHQQEPPFHWMGYELHPENWT
MQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVPLTQEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005