<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8338 77353 Portugal 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 134
2 D4T+ 3TC+ IDV 208
3 D4T+ 3TC+ IDV+ RTV 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, I13IV, I15V, L19I, M36L, R41K, I62V, L63P, I64V, H69K, L89M, I93L, C95F  
>77353| codons 1-99
PQITLWQRPIVTVKVGGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFVKVRQYD
QVPVEICGKKAIGTVLVGPTPANIIGRNMLTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98G V35T, T39DE, S48T, V60I, K122E, D123S, I135V, K173A, D177E, T200A, Q207D, R211K, V245Q, A272P, K277KR, E291D, V292I, I293V  
>77353| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005