<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL7179 94478 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ 3TC 100
2 D4T+ DDI+ NVP+ IDV+ RTV 69
3 D4T+ DDI+ 3TC+ ABC 152
4 DDI+ 3TC+ TDF 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V       L34I, V35T, K43R, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207N, L210LS, F214FL, L228LR, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E, D324E, I329V, Q334R  
>94478| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTGWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLSRWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, E35D, M36I, R41K, L63P, H69K, K70R, V82I, L89I  
>94478| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPINIIGRNILTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005