<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL53397 101698 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+EFV+IDV 114

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   T12TA, I13V, K14R, I15V, K20I, E35D, M36I, R41K, L63P, H69K, A71V, L89T  
>101698| codons 1-99
PQITLWQRPLVAVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNTMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184I   K101E, Y181C, M230L   V35T, S68G, V90VI, A98S, K122E, D123S, I135R, I167IV, K173R, Q174K, D177E, I195IL, T200A, I202V, R211S, V245Q, E248D, D250E, A272P, L283I, T286A, E291D, V292I, I293V, D324E, L325I, I326V, I329V D237A
>101698| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKVLEPFRRKNPEIVI
CQYIDDLYVGSDLELGQHRAKVEELRQHLLSWGFTTPDKKHQKEPPFLWLGYELHPAKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKEIVAEVQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005