<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL52835 100333 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ TDF+ LPV 17
2 3TC+ TDF+ LPV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35K, T39TI, K43R, V60I, A98S, D121Y, K122E, I135T, K173GV, Q174K, D177E, I178IV, I180IV, T200A, Q207K, R211NS, V245Q, D250E, A272P, T286A, E291A, V292I, I293V, E297A, D320E, D324E, I329V, Q334R  
>100333| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICIEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEVVV
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTAIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12TA, I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>100333| codons 1-99
PQITLWQRPLIAVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005