<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL52707 100301 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ EFV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75IT   K103N V179E, K238T E28K, V35T, I50IV, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293IV, E297A, D320E, D324E, I329V  
>100301| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICTEMEKEGKISKVGPENPYNTPI
FAIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIEI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, V82I, L89M H69E
>100301| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGEKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005