<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt-J ptJW36 U.S. 1996 HIV1 B PBMC MMC

Treatment History
Order Regimen Weeks
1 IDV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M L33I L10I, Q18E, K20R, E35D, M36I, N37S, L63P, L89M, I93L  
>ptJW36| 11 | codons 1-99 | clone 11
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 10 | codons 1-99 | clone 10
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 9 | codons 1-99 | clone 9
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMAQLGCALNF
>ptJW36| 8 | codons 1-99 | clone 8
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 7 | codons 1-99 | clone 7
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 6 | codons 1-99 | clone 6
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 5 | codons 1-99 | clone 5
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 4 | codons 1-99 | clone 4
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 3 | codons 1-99 | clone 3
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| 1 | codons 1-99 | clone 1
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF
>ptJW36| codons 1-99
PQITLWQRPIVTIKIGGELREALLDTGADDTVIEDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNMMTQLGCTLNF

References
Author Title Citation
Condra, JH Genetic correlates of in vivo viral resistance to indinavir, a human immunodeficiency virus type 1 protease inhibitor. J Virol, 1996
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005