<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL52393 99133 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ EFV 64
2 3TC+ TDF+ EFV 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4S, L10I, I13V, G17E, K20I, E35D, M36I, R41K, L63M, H69K, V82I, L89M  
>99133| codons 1-99
PQISLWQRPIVTVKIGEQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIMIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, M184V   K101P, K103N   E28EK, V35T, T39L, V60I, A98S, D121H, K122E, I135T, K173I, Q174K, T200A, Q207K, R211S, V245Q, E248D, D250EG, A272P, T286A, E291D, V292I, I293V, P294A, E297T, D320E, D324E, I329V E29EG
>99133| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKGKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKDSTEWRKLVDFRELNKRTQDFWEVQLGIPHPSGLPKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKGSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVALTTEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005