<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL51713 97428 Portugal 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NVP 130
2 D4T+ 3TC+ EFV 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, Y181C V108I, V179VE K20KR, V35T, A98S, D123E, I135T, S162A, E169D, K173R, Q174A, D177E, T200A, Q207E, R211K, F214L, L228R, V245Q, A272P, T286A, E291D, V292I, I293V, E297A, I329L  
>97428| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRRANPEIEI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, N37S, R41K, H69K, L89M  
>97428| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005