<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL49867 92554 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 DDI+ 3TC+ EFV 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35T, E40D, K49R, V60I, A98S, K102GR, K122E, D123S, E169EK, K173I, Q174K, D177E, T200A, Q207K, R211S, H221Y, V245Q, E248D, D250E, A272P, K275Q, K277R, T286A, E291D, V292I, I293V, E297A, D324E, I326V V317VF
>92554| codons 1-327
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGFYYDPSKELVA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, K20I, E35D, M36I, R41K, R57K, H69K, V82I, L89M  
>92554| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005