<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL49358 91289 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 104
2 None 252
3 DDI+ 3TC+ EFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MIV T215E K103N V179E E28K, V35T, K43R, V60VI, W88C, A98S, K122E, D123S, I135T, S163C, K173L, Q174K, D177E, I178M, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E, I329V  
>91289| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSCMTKILEPFRLKNPEMEI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFETPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, E35D, M36I, R41K, H69K, K70KR, V82I, L89M  
>91289| codons 1-98
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005