<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL48406 88662 Portugal 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ EFV 52
2 D4T+ ABC+ APV 104
3 AZT+ 3TC+ ABC 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215F V75M, K219W Y181C, G190S V179VF E28K, K32E, V35T, K49R, V60I, K101Q, K122E, I135V, S162C, E169D, K173A, Q174K, D177E, I178L, Q207D, H208HY, R211K, L228H, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297AT P52PS
>88662| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICTELEKEGKISRIGSENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPELFI
CQYMDDLYVSSDLEIGQHRTKIEELRDYLWKWGFFTPDWKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50IV, V82A L33F L10I, T12I, I13V, I15IV, G16E, K20R, E35D, M36I, R41K, R57K, Q61N, G68E, I72R, L89M  
>88662| codons 1-99
PQITLWQRPIVIVKVEGQLREALLDTGADDTVFEDINLPGKWKPKIIGGVGGFIKVKQYD
NILIEICEHKARGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005