<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL4725 100703 Portugal 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+D4T+DDI+LPV 109
3 3TC+APV+LPV+TDF 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48V, I54V, V82S, L90M V11VI, L33F, Q58E L10V, I13V, I15V, L19I, K20R, E35D, M36I, N37D, R41RK, K55R, I62V, L63P, H69K, K70KR, A71T, I72IM, T74S, I85V, L89I, I93L, C95F, T96S  
>100703| codons 1-99
PQITLWQRPVITVKVGGQIREALLDTGADDTVFEDIDLPGKWKPKLIVGIGGFVRVREYD
QVPIEICGKRTMGSVLVGPTPSNIVGRNIMTQLGFSLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219W K101E, Y181C A98G, V108I K20R, E28K, K32E, V35K, T39E, V118I, K122E, D123S, I135T, E138A, K173A, D177G, V179VI, T200A, E203K, L205F, Q207D, H208Y, L210S, R211K, D218E, K223Q, L228H, Q242K, V245Q, K275Q, T286A, E291D, V292I, I293V, Q334E  
>100703| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALKEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTILDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIII
CQYVDDLYVGSDLEIGQHRAKIKEFRDYLSKWGFFTPEWKHQQEPPFHWMGYELHPDKWT
VKPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005