<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL4725 69936 Portugal 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+D4T+DDI+LPV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, L90M Q58E L10V, I15V, L19I, K20R, E35D, M36I, N37D, R41K, K55R, I62V, L63P, H69K, A71T, T74S, I85V, L89I, I93L, C95CF  
>69936| codons 1-99
PQITLWQRPVVTIKVGGQIREALLDTGADDTVLEDIDLPGKWKPKMIVGIGGFVRVREYD
QVPIEICGKKTIGSVLVGPTPSNIVGRNIMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219W K101E, Y181C A98G K20R, E28K, K32E, V35K, T39E, S48T, V118I, K122E, D123S, I135T, E138A, K173A, D177G, V179I, T200A, L205F, Q207D, H208Y, L210S, R211K, D218E, K223Q, L228H, V245Q, K275Q, T286A, E291D, V292I, I293V, Q334E Q242QHKN
>69936| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALKEICEEMEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIII
CQYVDDLYVGSDLEIGQHRAKIEEFRDYLSKWGFFTPEWKHQQEPPFHWMGYELHPDKWT
VNPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005