<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL47066 85002 Portugal 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 74
2 AZT+ 3TC+ NFV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T27S, V35T, E36A, T39E, S48T, K122E, D123S, I135IMV, K166R, K173A, D177E, Q207E, V245Q, D250E, K277R, T286A, E291D, V292I, I293V, K311R  
>85002| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12S, I13V, I15V, L19I, E35ED, M36I, R41K, L63P, H69K, T74A, L89M, I93L  
>85002| codons 1-99
PQITLWQRPLVSVKVGGQIKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGAVLVGPTPVNIIGRDMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005