<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL46739 84133 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 25
2 DDI+ TDF+ EFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184MV   L100LI, K103KN V108VIM, P225PH V35T, K43R, V60I, K64R, V90I, A98S, K122E, D123S, S162A, K173KR, Q174E, D177E, I195K, T200A, V245Q, E248A, D250E, A272P, V276IT, K277KR, T286A, E291D, V292I, I293V, E297AT, D320E, D324E, I329V, Q334P  
>84133| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIRRKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGIKKNKSVTMLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRRENPEIVI
YQYVDDLYVGSDLEKGQHRAKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIQLPAKESWTVNDIQKLVGKLNWASQIYPGIKTRQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>84133| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005