<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL45677 100951 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 43
2 D4T+ 3TC+ EFV 209

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KNRS, Y188YFHL, G190GA   V21I, V35T, V60VI, A98S, K104KR, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, K275QR, K277R, T286A, E291D, V292I, I293V, E297A, D320E, D324E, I329V, Q334L  
>100951| codons 1-335
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKSRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLLVASDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90LM   I13V, K14R, K20I, E35D, M36I, R41K, I62IV, H69K, L89I  
>100951| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNIMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005