<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL45675 81585 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 34
2 AZT+ 3TC 143
3 D4T+ 3TC+ NVP 201

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   Y181C, G190A A98G K20R, V21I, V35T, K49KR, V60I, K101Q, K122E, D123S, I135V, K166R, K173A, Q174R, D177E, I178M, T200A, Q207E, R211K, V245Q, E248N, S251I, A272P, K277R, E291D, V292I, E297A, L301M, D324E, I329V  
>81585| codons 1-332
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRARNPEMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDIWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIIPLTAEAE
MELAENREILKEPVHGVYYDPSKELIAEVQKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, R57K, L63P, C67E, H69K, V82I, L89M  
>81585| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005