<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL45291 105157 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV 8
2 D4T+ 3TC+ NFV 56
3 D4T+ TDF+ EFV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N P225H V35I, V60I, V90I, A98S, K122E, D123S, I135L, I142V, K173I, Q174K, D177E, I178L, T200A, Q207K, R211S, V245Q, D250E, S251D, A272P, K275KQ, T286A, E291ED, V292I, I293V, E297A, D320E, D324E, I329V  
>105157| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDQKHQKEHPFLWMGYELHPDKWT
VQPIQLPEKEDWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23I I13V, K20I, E35G, M36I, R41K, H69K, T74S, V82I, L89M  
>105157| codons 1-99
PQITLWQRPLVTVKIGGQLIEAILDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPINIIGRNMMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005