<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL44044 77623 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ RTV 47
2 D4T+ DDI+ IDV+ RTV 4
3 D4T+ DDI+ NFV 52
4 D4T+ DDI+ NFV+ 3TC+ ABC+ EFV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR V75VA     V35T, V60I, A98S, D121H, K122E, K166R, K173I, Q174K, D177E, G196E, T200A, E204D, Q207K, R211S, V245Q, E248D, D250E, A272P, K277R, T286A, I293V, E297R, E298D, Q334L  
>77623| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLADFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEDLRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTRDAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VA   L10LI, I13V, K14R, K20I, E35D, M36I, R41K, L63LP, H69K, A71AV, T74S, L89I  
>77623| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGSVLVGPTPANIIGRNILTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005