<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL43562 76535 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV+ SQV 86
2 None 252
3 D4T+ 3TC+ NVP 128

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215F K219Q K101KPQT, K103S, G190A   T7TAP, E28EA, V35T, T39TA, V60I, A98S, D121H, K122E, I135T, K166R, Q174E, D177E, T200A, I202IV, Q207K, R211N, V245Q, E248D, D250E, A272P, T286A, V292I, I293V, E297A, I329V, K331N  
>76535| codons 1-334
PISPIEPVPVKLKPGMDGPKVKQWPLTAEKIKALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLTKSKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKENPEIVI
YQYVDDLYVASDLEIGQHRAKVEELRKHLLNWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQNQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S   I13V, K14R, I15V, K20I, E35D, M36I, R41K, L63P, H69K, A71V, T74S, L89I  
>76535| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGSVLVGPTPSNIIGRNILTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005