<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL43110 75401 Portugal 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 208
2 AZT+ 3TC+ NVP 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, N37D, R41K, I62V, L63T, H69K, L89M  
>75401| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QVTIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V K103N   V35T, T39E, I135T, A158S, K173A, D177E, T200A, K201I, E204K, Q207A, R211RS, P243PS, V245EK, A272P, E291D, I293V, E312N N54I
>75401| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPEIPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAIIEKLRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005