<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL43077 75315 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 43
2 AZT+ 3TC+ NVP 8
3 AZT+ 3TC+ NFV 224

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L90M   I13V, K14R, L19I, K20I, E35N, M36I, R41K, K55KR, R57RK, H69K, V82I, L89M  
>75315| codons 1-99
PQITLWQRPLVTVRIGGQIIEALLDTGADDTVLENINLPGKWKPKLIGGIGGFVRVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       V21I, T27P, V35T, K43R, A98S, K122E, D123S, I135T, K173N, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, P321S, D324E, I329V, K331N, Q332K  
>75315| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLPEEKIKALTEICTELEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDSSKELIAEVQNKG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005