<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL42083 72851 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV 121
2 AZT+ 3TC+ IDV+ RTV 93

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L10I, I13V, K14R, I15IV, K20I, E35D, M36V, N37ND, R41K, R57RK, D60DE, L63LP, H69K, A71AV, L89I  
>72851| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEDVDLPGKWKPKIIGGIGGFVKVKQYE
QIPIEICGKKVIGTVLVGPTPFNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y       V21I, V35T, V60I, K122E, D123DG, I135V, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A K73KNT, N136K
>72851| codons 1-320
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRTLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVKNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005