<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL42056 72786 Portugal 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ IDV 69
2 D4T+ 3TC+ IDV+ ABC+ RTV 206

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L10F, L24I, I54C T12TS, I13IV, G17D, L19I, K20R, M36I, R41K, K45R, L63P, H69K, A71V, L89I, I93L  
>72786| codons 1-99
PQITLWQRPFVSVKIGDQIREALIDTGADDTVLEEINLPGKWKPRMIGGIGGFCKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNILTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005