<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL41108 70726 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NVP 43
2 D4T+ 3TC 30
3 D4T+ 3TC+ EFV 114

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E K103N V179E V35T, V60I, A98S, K122E, D123GS, I135T, K173I, Q174K, D177E, T200A, Q207K, R211N, V245Q, E248D, D250E, A272P, T286A, A288AT, E291D, V292I, I293V, E297A, L301M, D324E, I329V, Q334P  
>70726| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIEI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLNWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
MELAENREILKEPVHGVYYDPSKELIAEVQKQGPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>70726| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005