<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL4054 67728 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ SQV 30
2 AZT+ 3TC+ SQV+ D4T+ IDV+ NFV 25
3 D4T+ 3TC+ IDV+ NFV+ NVP 200

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, L90M   I13V, K14R, I15V, K20T, E35DN, M36I, R41K, D60DE, I62IV, H69K, T74S, V82I, L89I  
>67728| codons 1-99
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLENINLPGKWKPKLIGGIGGFVKVRQYE
QVLIEICGKKAIGSVLVGPTPINIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215FY K219E     V35T, V60I, S68G, A98S, K122E, D123S, I135T, S162F, K173IR, Q174K, D177E, T200A, Q207K, R211S, L228LH, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, V317VA, D324DE, I329V  
>67728| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005