<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL40517 69351 Portugal 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 295
2 D4T+ DDI+ IDV 130
3 D4T+ DDI+ NFV 111

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I15V, G17D, K20T, E35D, M36I, R57K, Q61H, L63P, I64V, A71T, I72V, L89M, I93L  
>69351| codons 1-99
PQITLWQRPIVTIKVGDQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
HIPVEICGHKTVGTVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q     V35T, V60I, D123E, S162C, E169D, K173A, Q174K, I178L, E203D, Q207E, R211K, D218E, K223Q, L228H, V245Q, E248D, A272P, E291D, V292I, I293V, P294T, E297T, S322T, I329L  
>69351| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYMDDLYVGSDLEIGQHRTKIDELREHLLKWGFFTPEQKHQQEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVTLTTEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005