<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL40388 105421 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ IDV 190

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, K43KR, V60I, A98S, K122E, D123S, I135IT, K173R, Q174K, D177E, I195KT, T200A, R211NS, D218DE, V245Q, E248D, D250E, A272P, K275Q, V276T, K277R, T286A, E291D, V292I, I293V, E297A, D324E, I329V  
>105421| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLETGQHRAKIEELRQHLLSWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIQTRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82T, I84V L89MV L10I, I13V, K14R, I15V, K20I, E35D, M36I, R41K, Q61QH, I62IV, L63LAPV, I66FL, H69K, A71AV, T74TS  
>105421| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYD
HVVIELCGKKVIGSVLVGPTPTNVIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005