<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL37933 63674 Portugal 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NVP 26
2 DDI+ 3TC+ IDV 124

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV, T215*DEY   Y181C   V21I, V35M, K101Q, S162Y, K166KQ, E169AD, K173A, Q174K, E203EK, Q207E, R211K, L228LH, V245Q, E248D, A272P, K277R, T286TA, E291D, V292I, I293V, E297R, P313T, I326V  
>63674| codons 1-335
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTQILDPFRAKNPDIVI
CQYVDDLYVGSDLEIGQHRTKIKELREHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTREAE
LELAENREILKETVHGVYYDPSKDLVAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, G17E, Q18QH, K20IMT, E35D, M36I, I62V, L63P, L89IM  
>63674| codons 1-99
PQITLWQRPLVTIKVGEHLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005