<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL37498 95930 Portugal 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 99
2 D4T+ 3TC+ IDV 104
3 None 65
4 D4T+ 3TC+ IDV 4
5 None 34
6 AZT+ TDF+ LPV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G17D, K20M, E35D, M36I, R57K, Q61H, L89M  
>95930| codons 1-99
PQITLWQRPLVTIKVGDQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
HILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35T, K49R, D86E, I135V, S162C, E169D, K173A, Q174K, I178L, E203D, Q207A, R211K, V245Q, P247Q, A272P, K281R, E291D, V292I, I293V, P294T, E297T  
>95930| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYMDDLYVGSDLEIGQHRTKIDELRAHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLQEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDIVTLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005