<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL369 95591 Portugal 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+LPV+TDF 112

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, L90M L33F, K43T L10V, I15V, G16E, K20M, E35N, M36I, N37ND, R57K, Q61D, G68E, H69R, A71T, I72R, L89I, I93L  
>95591| codons 1-99
PQITLWQRPVVTIKVEGQLMEALLDTGADDTVFENIDLPGRWTPKLIVGIGGFVKVKQYD
DILIEICERKTRGTVLVGPTPANIIGRNIMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L210W, T215F K219W Y181C V108VI K20R, E28EK, V35M, T39K, K43E, K49KR, E53ED, K64Y, T69N, V118VI, D121Y, K122KE, D123DE, I135AT, S162DY, E169D, K173A, Q174K, D177E, Q207E, H208Y, R211K, L228H, Q242H, V245Q, E248D, A272P, T286A, A288T, E291D, V292I, I293V, E297A, V317A  
>95591| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALMEICKELEEEGKISRIGPDNPYNTPV
FAIYKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELREYLWKWGFFTPDWKHQKEPPFHWMGYELHPDKWT
VHPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005