<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34326 98448 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 61
2 D4T+ ABC+ NFV 56
3 D4T+ ABC+ EFV+ NFV 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y V75VL, K219R K103N, G190GA   S3SG, V35T, T39TA, K43R, V60I, V90VI, A98S, S117SA, K122E, D123S, I135T, Q174K, T200A, Q207K, H208HY, R211S, D218E, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297AV N54NI
>98448| codons 1-315
PIGPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEREGKISKIGPEIPYNTPI
FAIKKKNSTKWRKLLDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFAVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYMDDLYVASDLEIGQHRAKIEELRKYLLSWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTVEAE
LELAENREILKEPVH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82M L24I, Q58E, L89MV L10I, I13V, K14R, K20I, E35D, M36I, R41K, Q61N, L63T, H69K  
>98448| codons 1-99
PQITLWQRPIVTVRIGGQLIEALIDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVREYD
NITIEICGKKAIGTVLVGPTPMNIIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005