<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34031 55128 Portugal 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 87
2 D4T+ 3TC+ IDV 117
3 D4T+ 3TC+ NVP+ NFV 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L89V L10I, T12S, I13V, L19V, K20I, E35D, N37D, L63P, I66F, H69K, K70R, A71V  
>55128| codons 1-99
PQITLWQRPIVSVKIGGQVIEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEFCGKRVIGTVLVGPTPVNVIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005