<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL33730 76228 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 AZT+DDI+IDV+RTV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F   L10I, I13V, K14R, K20I, E35D, M36I, R41K, K45Q, H69K, L89M  
>76228| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPQMIGGIGGFVKVRQYD
QILIEICGKKAIGTVLVGPTPFNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215F   G190A   V21I, T27S, V35T, K43R, V60I, A98S, K122E, D123S, I135T, S162SN, R172RK, K173M, Q174K, D177E, T200A, Q207K, R211S, F214L, V245Q, E248D, D250E, A272P, T286A, E297K, E312~, Q334L Y318V
>76228| codons 1-335
PISPIETVPVKLKPGMDGPKIKQWPLSEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFKMKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRKHLLSWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILK~PVHGVVYDPSKDLIAEIQKQGLG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005