<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL3275 91552 Portugal 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 274
2 D4T+ 3TC+ SQV 282
3 AZT+ 3TC+ ABC 21
4 3TC+ TDF+ NVP 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV   L10IV, I13V, K20I, M36I, R41K, H69K, T74S, V75I, L89M  
>91552| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKKAIGSILVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q Y181YC, G190GA A98AG K11R, V35T, K43Q, V60I, K122E, D123DN, I135V, S162A, K173T, D177E, T200A, E203K, Q207E, R211K, V245K, D250E, S251H, T286A, E291D, V292I, I293V, P294T, V317VA, S322T  
>91552| codons 1-334
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICTEMEQEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
CQYVDDLYVASDLEIGQHRAKIKELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKEHWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGAYYDPTKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005