Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| PL31915 | 95985 | Portugal | 2004 | HIV1 | CRF02_AG | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ 3TC+ NVP | 13 |
| 2 | AZT+ 3TC+ NVP+ D4T+ ABC+ IDV | 21 |
| 3 | D4T+ ABC+ IDV+ DDI | 95 |
| 4 | D4T+ ABC+ IDV+ RTV | 39 |
| 5 | D4T+ ABC+ IDV | 51 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V11VI | L10V, I13V, K14R, G16E, L19LP, K20I, M36I, R41K, H69K, K70R, I72V, L89M |
| >95985| codons 1-99 PQITLWQRPVITVRIEGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |