<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL31915 95985 Portugal 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 13
2 AZT+ 3TC+ NVP+ D4T+ ABC+ IDV 21
3 D4T+ ABC+ IDV+ DDI 95
4 D4T+ ABC+ IDV+ RTV 39
5 D4T+ ABC+ IDV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI L10V, I13V, K14R, G16E, L19LP, K20I, M36I, R41K, H69K, K70R, I72V, L89M  
>95985| codons 1-99
PQITLWQRPVITVRIEGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005