<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL31915 79867 Portugal 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 13
2 AZT+ 3TC+ NVP+ D4T+ ABC+ IDV 21
3 D4T+ ABC+ IDV+ DDI 95
4 D4T+ ABC+ IDV+ RTV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI L10V, I13V, K14R, G16E, K20I, M36I, R41K, I64IV, H69K, K70R, I72V, L89M P1PS
>79867| codons 1-99
SQITLWQRPVITVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103N   V35KT, E36D, T39TA, W88C, K122Q, I135T, I142V, S162A, K173KI, Q174EK, D177E, T200A, Q207E, R211K, F214L, V245Q, A272P, V276I, K277R, T286A, E291D, V292VI, I293V, P294T, S322T, I329IV P157PS, F160FL
>79867| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSSAILQASMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEVQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005