<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL30686 101546 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ IDV+ RTV 95
2 AZT+ DDI 165
3 AZT+ 3TC+ IDV+ RTV 156
4 DDI+ TDF+ EFV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV   K103N, Y181C A98AG, V179E V35T, V60VI, K122E, D123S, I135M, K173T, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248DN, A272P, T286A, E291D, V292I, I293V, E297A, A304E, D320E, D324E, I329V  
>101546| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIEI
CQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELEENREILKEPVHGVYYEPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, E35D, M36I, R41K, I64IM, H69K, V82I, L89M  
>101546| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005