<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL30594 104269 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP+ NFV 288

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V L89V T12TI, I13A, K14R, L19P, K20I, E35D, M36I, N37D, R41K, H69K, V82I  
>104269| codons 1-99
PQITLWQRPLVIARIGGQPIEALLDTGADDTVLEDIDLPGKWKPKLIGGIGGFVKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, T215FY F116Y, K219Q Y181C   V35T, V60I, T69TA, A98S, K122E, D123S, I135V, M164L, I167IV, K173I, Q174K, D177E, T200A, L205F, Q207A, H208Y, R211RS, D218E, L228LH, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E, I329V, G333E, Q334E  
>104269| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSARWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSLTKVLEPFRIKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEEFRAYLLSWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQEEG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005