<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL29090 97083 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 126
2 AZT+ DDI+ D4T+ 3TC+ IDV 21
3 AZT+ DDI+ D4T+ 3TC+ NFV 82
4 D4T+ 3TC+ NFV 13
5 DDI+ 3TC+ RTV+ SQV 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82T   L10I, I13V, K14R, K20I, E35DN, M36V, H69K, K70E, A71V, L89I, I93L R41Q
>97083| codons 1-98
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLENVNLPGQWKPKLIVGIGGFVKVRQYD
QILIEICGKEVIGTVLVGPTPTNIIGRNILTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y       V21I, V35T, T39A, K43Q, V60I, V118I, K122E, D123N, I135T, K173I, Q174K, D177E, I178M, T200A, Q207E, R211K, I244IV, V245K, D250E, A272P, T286A, E291D, V292I, I293V, E297A, A304E, D324E, I329V  
>97083| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICAELEQEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPVKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELEENREILKEPVHGVYYDPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005