<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL28120 100793 Portugal 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 30
2 AZT+ 3TC+ ABC 108
3 3TC+ TDF+ LPV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76V L24LI, Q58E L10I, I13V, K20I, E35D, M36I, R41K, L63P, H69K, V82I, L89M  
>100793| codons 1-99
PQITLWQRPIVTVKIGGQLIEALIDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVREYD
QIPIEICGKKAIGTVVVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y       E28K, K32E, V35T, T39A, K43R, E44ED, V60I, A98S, K122E, D123N, I135T, K173IT, Q174K, D177E, T200A, E203ED, Q207K, H208HY, L210LS, R211DGNS, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E, I329V  
>100793| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICAELERDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRKYLSSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005