<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL27956 60622 Portugal 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 91
2 D4T+ 3TC+ NFV 113
3 D4T+ DDI+ NVP+ IDV+ RTV 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90MR   L10V, T12S, I15V, L19I, K20R, E35D, M36I, R41K, I62IV, L63P, H69K, A71AV, T74S, V77VI, I93L  
>60622| codons 1-99
PQITLWQRPVVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKVIGSVLIGPTPVNIIGRNLRTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q K103N, Y181C   E6EK, K11E, V35T, T39E, S48T, V60I, K122E, D123N, K166R, K173T, D177E, T200A, Q207E, R211K, D218E, L228LR, V245Q, A272P, K277R, E291D, V292I  
>60622| codons 1-329
PISPIKTVPVELKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPEQKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEI

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005