<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL26460 78692 Portugal 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T+ DDI 164

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, T215Y       V21I, T27S, K32R, V35T, T39A, V60I, I135V, S162A, K173T, Q174R, D177E, T200A, Q207E, R211K, V245Q, T286A, E291D, V292I, I293V, P294A, S322T, I326V  
>78692| codons 1-334
PISPIETVPVKLKPGMDGPKIKQWPLSEEKIRALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVALTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, K14R, G17E, K20I, M36I, R41K, G68E, H69K, K70R, L89M  
>78692| codons 1-99
PQITLWQRPLVPVRIGEQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICEKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005