<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL25022 57676 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+ DDI+ NVP 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, T215Y   Y188L   V35T, E40D, K49R, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177G, T200A, Q207K, R211S, V245Q, E248A, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297A, D320E, D324E  
>57676| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPGIVI
YQYMDDLLVGSDLEIGQHRAKIEELRKHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPAKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, K20I, E35D, M36I, R41K, R57K, H69K, V82I, L89M  
>57676| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005