<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL23900 101500 Portugal 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 104
2 DDI+EFV+LPV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33F, N83D L10V, I13V, K20R, E35D, M36I, R41K, R57K, I62V, T74S, L89I  
>101500| codons 1-99
PQITLWQRPVVTVKIGGQLREALLDTGADDTVFEDINLPGKWKPKMIGGIGGFVKVKQYD
QVLIEICGHKAIGSVLVGPTPADIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q V106M   K20R, V35I, T39A, K64Y, V118I, I135T, K173T, Q174K, T200A, Q207E, R211K, F214L, D218E, E224D, L228H, V245Q, E248D, D250E, A272P, L283I, T286A, E291D, V292I, I293V, P294T, E297P, V317A, G333E, Q334H  
>101500| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIYKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPEQKHQKDPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVTLTPEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQEHG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005