<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL21333 84771 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ IDV 78
2 D4T+ 3TC+ EFV 82
3 D4T+ DDI+ EFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89V I13V, K14R, K20I, E35D, M36I, R41K, L63LP, H69K, A71T  
>84771| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKTIGTVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103KN, Y188L   K20R, V35T, V60I, S68G, A98S, V106VI, K122E, D123S, K126KR, I135T, K173I, Q174K, D177EG, V179VM, T200A, I202V, Q207K, R211NS, F214L, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, L301M, D324E, I329V  
>84771| codons 1-332
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSITVLDVGDAYFSVPL
DESFRRYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPGIMI
YQYMDDLLVGSDLEIGQHRAKVEELRKHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYDPSKELIAEVQKQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005