<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL14814 78800 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 47
2 AZT+ 3TC+ NFV 161
3 D4T+ DDI+ 3TC+ NFV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   I13V, K14R, K20I, E35D, M36V, R41K, Q61H, I62V, L63P, C67E, H69K, A71I, T74S, V82I, L89I, I93M R87E
>78800| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDVNLPGKWKPKIIGGIGGFIKVRQYD
HVPIEIEGKKIIGSVLVGPTPINIIGENIMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y       K20R, K32I, V35A, T39K, K43E, K49R, V118I, K122E, D123N, I135V, E169A, K173A, Q174K, D177E, I178M, T200A, E203D, Q207E, H208Y, R211K, V245Q, E248D, A272P, E291D, V292I, I293V, E297A  
>78800| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIIALAEICKELEEEGKISRIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFRAKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIDELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005