<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL14482 74644 Portugal 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ EFV 261

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V K103N K238KT V35T, E36A, T39E, S48T, K49KR, K122E, D123N, I135T, A158S, S163ST, E169A, K173A, Q174K, D177E, T200A, Q207K, R211ST, V245Q, P247T, E248D, D250E, A272P, K277KR, E291D, V292I, I293V  
>74644| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITRIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSTMTKILAPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLTWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLTDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2H, L19T, M36I, R41K, H69K, L89M, I93L  
>74644| codons 1-99
PHITLWQRPLVTIKIGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005